| Name | KCNMA1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5126 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNMA1 Blocking Peptide |
| Description | Rabbit polyclonal KCNMA1 antibody raised against the middle region of KCNMA1 |
| Gene | KCNMA1 |
| Supplier Page | Shop |