Name | RBM42 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4934 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RBM42 antibody was raised using the middle region of RBM42 corresponding to a region with amino acids RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS |
Purity/Format | Affinity purified |
Blocking Peptide | RBM42 Blocking Peptide |
Description | Rabbit polyclonal RBM42 antibody raised against the middle region of RBM42 |
Gene | RBM42 |
Supplier Page | Shop |