Name | CETP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5448 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CETP antibody was raised using the N terminal of CETP corresponding to a region with amino acids ALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLGQVKYGLHNIQISHLS |
Purity/Format | Affinity purified |
Blocking Peptide | CETP Blocking Peptide |
Description | Rabbit polyclonal CETP antibody raised against the N terminal of CETP |
Gene | CETP |
Supplier Page | Shop |