| Name | SQLE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1955 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse |
| Antigen | SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
| Purity/Format | Affinity purified |
| Blocking Peptide | SQLE Blocking Peptide |
| Description | Rabbit polyclonal SQLE antibody raised against the C terminal of SQLE |
| Gene | SQLE |
| Supplier Page | Shop |