| Name | RXRA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1923 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RXRA antibody was raised using the C terminal of RXRA corresponding to a region with amino acids MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | RXRA Blocking Peptide |
| Description | Rabbit polyclonal RXRA antibody raised against the C terminal of RXRA |
| Gene | RXRA |
| Supplier Page | Shop |