Anti-C9orf68 antibody
| Name | Anti-C9orf68 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94439 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 288-337 (LDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG S) of Human C9orf68 (NP_001034484) |
| Description | Rabbit Polyclonal |
| Gene | SPATA6L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C9orf68 antibody (ab94439) at 1 µg/ml + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution