Anti-C9ORF4 antibody
| Name | Anti-C9ORF4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98878 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 215-264, (HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNV P) of Human C9ORF4 (NP_055149) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FRRS1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C9ORF4 antibody (ab98878) at 1 µg/ml + ACHN cell lysate at 10 µg