Name | Anti-C9ORF4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab98878 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 215-264, (HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNV P) of Human C9ORF4 (NP_055149) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | FRRS1L |
Conjugate | Unconjugated |
Supplier Page | Shop |