Name | Anti-C17orf64 antibody |
---|---|
Supplier | Abcam |
Catalog | ab98061 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rabbit, Horse, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 186-235 ( NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE ) of Human C17orf64 (NP_859058) |
Description | Rabbit Polyclonal |
Gene | C17orf64 |
Conjugate | Unconjugated |
Supplier Page | Shop |