Name | Anti-ADH4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab83819 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P WB |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 108-157 ( PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV ) of Human ADH4 (NP_000661) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ADH4 |
Conjugate | Unconjugated |
Supplier Page | Shop |