Anti-ADH4 antibody
| Name | Anti-ADH4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83819 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 108-157 ( PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV ) of Human ADH4 (NP_000661) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ADH4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling ADH4 with ab83819 at 1.25µg/ml.
Anti-ADH4 antibody (ab83819) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution