Anti-4930567H17Rik antibody
| Name | Anti-4930567H17Rik antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128307 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Bovine, Cat, Dog, Pig, Yeast, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 101-150 ( TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE ) of Mouse 4930567H17Rik (NP_001028979) |
| Description | Rabbit Polyclonal |
| Gene | 4930567H17Rik |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-4930567H17Rik antibody (ab128307) at 1 µg/ml + Mouse kidney lysate at 10 µg