Name | FANCF Antibody (3C4) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002188-M03 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 3C4 |
Applications | ELISA ICC/IF |
Species Reactivities | Human |
Antigen | FANCF (NP_073562.1, 1 a.a. - 91 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDV |
Purity/Format | Protein A purified |
Description | Mouse Monoclonal |
Gene | FANCF |
Conjugate | Unconjugated |
Supplier Page | Shop |