Name | BAI2 Antibody (6A12) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00000576-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG3 Kappa |
Clone | 6A12 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | BAI2 (NP_001694, 22 a.a. - 108 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | ADGRB2 |
Conjugate | Unconjugated |
Supplier Page | Shop |