SOX22 Antibody (2A6)

Name SOX22 Antibody (2A6)
Supplier Novus Biologicals
Catalog H00006666-M06
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 2A6
Applications WB ELISA
Species Reactivities Human
Antigen SOX12 (NP_008874 252 a.a. - 313 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Purity/Format IgG purified
Description Mouse Monoclonal
Gene SOX12
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.