Name | SOX22 Antibody (2A6) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00006666-M06 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 2A6 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | SOX12 (NP_008874 252 a.a. - 313 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | SOX12 |
Conjugate | Unconjugated |
Supplier Page | Shop |