Name | RPS28 Antibody (2F9) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00006234-M02 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 2F9 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | RPS28 (NP_001022, 1 a.a. - 55 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | RPS28 |
Conjugate | Unconjugated |
Supplier Page | Shop |