Name | Fucosyltransferase 7/FUT7 Antibody (1A12) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002529-M05 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1A12 |
Applications | ELISA |
Species Reactivities | Human |
Antigen | FUT7 (NP_004470 262 a.a. - 342 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | FUT7 |
Conjugate | Unconjugated |
Supplier Page | Shop |