Fucosyltransferase 7/FUT7 Antibody (1A12)
| Name | Fucosyltransferase 7/FUT7 Antibody (1A12) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002529-M05 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1A12 |
| Applications | ELISA |
| Species Reactivities | Human |
| Antigen | FUT7 (NP_004470 262 a.a. - 342 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | FUT7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: Fucosyltransferase 7/FUT7 Antibody (1A12) [H00002529-M05] - Detection limit for recombinant GST tagged FUT7 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21658_Fucosyltransferase%25207-FUT7%2520Antibody%2520(1A12)-Sandwich%2520ELISA-H00002529-M05-img0002.jpg)
Sandwich ELISA: Fucosyltransferase 7/FUT7 Antibody (1A12) [H00002529-M05] - Detection limit for recombinant GST tagged FUT7 is approximately 0.1ng/ml as a capture antibody.