CLPS Antibody (4G3)
| Name | CLPS Antibody (4G3) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001208-M05 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 4G3 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | CLPS (NP_001823, 23 a.a. - 112 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CLPS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CLPS Antibody (4G3) [H00001208-M05] - Analysis of CLPS expression in transfected 293T cell line by CLPS monoclonal antibody (M05), clone 4G3. Lane 1: CLPS transfected lysate (Predicted MW: 12 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12128_CLPS%2520Antibody%2520(4G3)-Western%2520Blot-H00001208-M05-img0002.jpg)
Western Blot: CLPS Antibody (4G3) [H00001208-M05] - Analysis of CLPS expression in transfected 293T cell line by CLPS monoclonal antibody (M05), clone 4G3. Lane 1: CLPS transfected lysate (Predicted MW: 12 KDa). Lane 2: Non-transfected lysate.
![ELISA: CLPS Antibody (4G3) [H00001208-M05] - Detection limit for recombinant GST tagged CLPS is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12129_CLPS-Antibody-(4G3)-ELISA-H00001208-M05-img0001.jpg)
ELISA: CLPS Antibody (4G3) [H00001208-M05] - Detection limit for recombinant GST tagged CLPS is approximately 0.03ng/ml as a capture antibody.