Calmodulin 3 Antibody

Name	Calmodulin 3 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-98474
Prices	$139.00, $329.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB
Species Reactivities	Human
Antigen	The immunogen for this antibody is Calmodulin 3 - N-terminal region. Peptide sequence LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	CALM3
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human HepG2, Antibody Dilution: 1.0 ug/ml CALM3 is supported by BioGPS gene expression data to be expressed in HepG2.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human MCF7, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.