TBPL2 Antibody

Name TBPL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-80268
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the N terminal of mouse TRF3. Peptide sequence FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene Tbpl2
Conjugate Unconjugated
Supplier Page Shop

Product images