| Name | HSH2D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79862 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human HSH2DThe immunogen for this antibody is HSH2D. Peptide sequence DPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HSH2D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |