PIGF Antibody
| Name | PIGF Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69261 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PIGF(phosphatidylinositol glycan anchor biosynthesis, class F) The peptide sequence was selected from the N terminal of PIGF. Peptide sequence MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PIGF |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PIGF Antibody [NBP1-69261] - This Anti-PIGF antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22679_PIGF-Antibody-Western-Blot-NBP1-69261-img0001.jpg)
Western Blot: PIGF Antibody [NBP1-69261] - This Anti-PIGF antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry: PIGF Antibody [NBP1-69261] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22680_PIGF%2520Antibody-Immunohistochemistry-NBP1-69261-img0002.jpg)
Immunohistochemistry: PIGF Antibody [NBP1-69261] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.