NOR1/OSCP1 Antibody

Name NOR1/OSCP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57771
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C1orf102 (organic solute carrier partner 1) The peptide sequence was selected from the N terminal of C1orf102)(50ug). Peptide sequence ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OSCP1
Conjugate Unconjugated
Supplier Page Shop

Product images