TTC23L Antibody

Name TTC23L Antibody
Supplier Novus Biologicals
Catalog NBP1-57634
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FLJ25439 The peptide sequence was selected from the N terminal of FLJ25439. Peptide sequence MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TTC23L
Conjugate Unconjugated
Supplier Page Shop

Product images