PIGL Antibody

Name PIGL Antibody
Supplier Novus Biologicals
Catalog NBP1-56987
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIGL (phosphatidylinositol glycan anchor biosynthesis, class L) The peptide sequence was selected from the N terminal of PIGL. Peptide sequence MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PIGL
Supplier Page Shop

Product images