Name | PIGL Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56987 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PIGL (phosphatidylinositol glycan anchor biosynthesis, class L) The peptide sequence was selected from the N terminal of PIGL. Peptide sequence MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | PIGL |
Supplier Page | Shop |