CCDC144NL Antibody

Name CCDC144NL Antibody
Supplier Novus Biologicals
Catalog NBP1-57054
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MGC87631 (coiled-coil domain containing 144 family, N-terminal like) The peptide sequence was selected from the middle region of MGC87631. Peptide sequence VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVAC
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC144NL
Conjugate Unconjugated
Supplier Page Shop

Product images