| Name | Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69352 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GNS(glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID)) The peptide sequence was selected from the C terminal of GNS. Peptide sequence PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GNS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |