STARD8 Antibody
| Name | STARD8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69098 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8. Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | STARD8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: STARD8 Antibody [NBP1-69098] - Titration: 1.0 ug/ml Positive Control: 293T Whole Cell.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7158_STARD8-Antibody-Western-Blot-NBP1-69098-img0002.jpg)
Western Blot: STARD8 Antibody [NBP1-69098] - Titration: 1.0 ug/ml Positive Control: 293T Whole Cell.
![Western Blot: STARD8 Antibody [NBP1-69098] - Lanes: Lane 1 : 30ug STARD8 transfected HEK293T lysate Lane 2: 30ug HEK293T lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 10,000 Gene name: STARD8 Submitted by: Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O. L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7159_STARD8%2520Antibody-Western%2520Blot-NBP1-69098-img0003.jpg)
Western Blot: STARD8 Antibody [NBP1-69098] - Lanes: Lane 1 : 30ug STARD8 transfected HEK293T lysate Lane 2: 30ug HEK293T lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 10,000 Gene name: STARD8 Submitted by: Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O. L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong.