Name | AXUD1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56324 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to AXUD1 (cysteine-serine-rich nuclear protein 1) The peptide sequence was selected from the middle region of AXUD1)(50ug). Peptide sequence ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CSRNP1 |
Conjugate | Unconjugated |
Supplier Page | Shop |