AXUD1 Antibody

Name AXUD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56324
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AXUD1 (cysteine-serine-rich nuclear protein 1) The peptide sequence was selected from the middle region of AXUD1)(50ug). Peptide sequence ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CSRNP1
Conjugate Unconjugated
Supplier Page Shop

Product images