MPG1 Antibody

Name MPG1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70641
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MPEG1(macrophage expressed gene 1) The peptide sequence was selected from the middle region of MPEG1. Peptide sequence TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MPEG1
Conjugate Unconjugated
Supplier Page Shop

Product images