FTHL17 Antibody

Name FTHL17 Antibody
Supplier Novus Biologicals
Catalog NBP1-59482
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FTHL17(ferritin, heavy polypeptide-like 17) The peptide sequence was selected from the middle region of FTHL17. Peptide sequence FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FTHL17
Conjugate Unconjugated
Supplier Page Shop

Product images