ACF Antibody

Name ACF Antibody
Supplier Novus Biologicals
Catalog NBP1-57313
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to A1CF(APOBEC1 complementation factor) The peptide sequence was selected from the N terminal of A1CF. Peptide sequence MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACF
Conjugate Unconjugated
Supplier Page Shop

Product images