C9orf68 Antibody

Name C9orf68 Antibody
Supplier Novus Biologicals
Catalog NBP1-56828
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C9ORF68 The peptide sequence was selected from the middle region of C9ORF68. Peptide sequence CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPATA6L
Conjugate Unconjugated
Supplier Page Shop

Product images