SOHLH1 Antibody

Name SOHLH1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56454
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SOHLH1(spermatogenesis and oogenesis specific basic helix-loop-helix 1) The peptide sequence was selected from the middle region of SOHLH1. Peptide sequence EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKM
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SOHLH1
Supplier Page Shop

Product images