SH3MD4 Antibody
| Name | SH3MD4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31005 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LISSSDPRAAARIGDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SH3MD4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SH3RF3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SH3MD4 Antibody [NBP2-31005] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10269_SH3MD4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31005-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SH3MD4 Antibody [NBP2-31005] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & centrosome.
![Immunohistochemistry-Paraffin: SH3MD4 Antibody [NBP2-31005] - Staining of human duodenum shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10270_SH3MD4-Antibody-Immunohistochemistry-Paraffin-NBP2-31005-img0003.jpg)
Immunohistochemistry-Paraffin: SH3MD4 Antibody [NBP2-31005] - Staining of human duodenum shows strong nuclear positivity in glandular cells.