GPBP Antibody

Name GPBP Antibody
Supplier Novus Biologicals
Catalog NBP1-87980
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:LKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDENEIPQENGNASVISQQIIRSSTFPQTDVLSSSL
Purity/Format Immunogen affinity purified
Blocking Peptide GPBP Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene COL4A3BP
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.