Angiopoietin-like Protein 6/ANGPTL6 Antibody
| Name | Angiopoietin-like Protein 6/ANGPTL6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89210 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VGSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQ |
| Description | Rabbit Polyclonal |
| Gene | ANGPTL6 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Angiopoietin-like Protein 6/ANGPTL6 Antibody [NBP1-89210] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25865_Angiopoietin-like-Protein-6-ANGPTL6-Antibody-Immunohistochemistry-NBP1-89210-img0003.jpg)
Immunohistochemistry: Angiopoietin-like Protein 6/ANGPTL6 Antibody [NBP1-89210] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.