HSH2D Antibody
| Name | HSH2D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89109 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RITSKEATSSCPPKSPLGETRQKLWRSLKMLPERGQRVRQQLKSHLATVNLSSLLDVRRSTVISGPGTGKGSQDHSGD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HSH2D Protein |
| Description | Rabbit Polyclonal |
| Gene | HSH2D |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: HSH2D Antibody [NBP1-89109] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25829_HSH2D-Antibody-Immunohistochemistry-NBP1-89109-img0003.jpg)
Immunohistochemistry: HSH2D Antibody [NBP1-89109] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.