FADS6 Antibody
| Name | FADS6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14490 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GHSIISCHVEHHLFPRLSDNMCLKVKPVVSQFLREKQLPYNEDSYLARFQ LFLRRYEEFMVQAPPITELV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FADS6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FADS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: FADS6 Antibody [NBP2-14490] - Staining of human fallopian tube shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20000_FADS6-Antibody-Immunohistochemistry-NBP2-14490-img0002.jpg)
Immunohistochemistry: FADS6 Antibody [NBP2-14490] - Staining of human fallopian tube shows strong cytoplasmic positivity in subset of glandular cells.