ATP5S Antibody

Name ATP5S Antibody
Supplier Novus Biologicals
Catalog NBP2-14333
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFN KVDYDRIRDVGPDRAASEWLLRC
Purity/Format Immunogen affinity purified
Blocking Peptide ATP5S Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ATP5S
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.