Syncollin Antibody
| Name | Syncollin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13402 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNA ISALYCRCP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Syncollin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYCN |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Syncollin Antibody [NBP2-13402] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25002_Syncollin%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13402-img0001.jpg)
Immunohistochemistry-Paraffin: Syncollin Antibody [NBP2-13402] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.