TINP1 Antibody
| Name | TINP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13675 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMV TKVCFVGDGFTRKPPKYERFIRPMGLRF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TINP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NSA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TINP1 Antibody [NBP2-13675] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10914_TINP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13675-img0001.jpg)
Immunohistochemistry-Paraffin: TINP1 Antibody [NBP2-13675] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.