Collagen VI alpha 3 Antibody
| Name | Collagen VI alpha 3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34837 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Collagen VI alpha 3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | COL6A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Collagen VI alpha 3 Antibody [NBP2-34837] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line U-87 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10469_Collagen-VI-alpha-3-Antibody-Western-Blot-NBP2-34837-img0005.jpg)
Western Blot: Collagen VI alpha 3 Antibody [NBP2-34837] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line U-87 MG
![Immunohistochemistry: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human ovary shows moderate cytoplasmic positivity in ovarian stromal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10470_Collagen-VI-alpha-3-Antibody-Immunohistochemistry-NBP2-34837-img0001.jpg)
Immunohistochemistry: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human ovary shows moderate cytoplasmic positivity in ovarian stromal cells.
![Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Lane view shows a specific band for Collagen IV alpha3 in 0.2 mg/ml of WI-38 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10471_Collagen-VI-alpha-3-Antibody-Simple-Western-NBP2-34837-img0006.jpg)
Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Lane view shows a specific band for Collagen IV alpha3 in 0.2 mg/ml of WI-38 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Electropherogram image of the corresponding Simple Western lane view. Collagen IV alpha3 antibody was used at 1:25 dilution on WI-38 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10472_Collagen-VI-alpha-3-Antibody-Simple-Western-NBP2-34837-img0007.jpg)
Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Electropherogram image of the corresponding Simple Western lane view. Collagen IV alpha3 antibody was used at 1:25 dilution on WI-38 lysate(s) respectively.