HPCL Antibody
| Name | HPCL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37877 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAASVIRNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HPCL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HACL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: HACL1 Antibody [NBP2-37877] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/353_HACL1%2520Antibody-Immunohistochemistry-NBP2-37877-img0001.jpg)
Immunohistochemistry: HACL1 Antibody [NBP2-37877] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.