NDUFA8 Antibody (2E10.)

Name	NDUFA8 Antibody (2E10.)
Supplier	Novus Biologicals
Catalog	H00004702-M05
Prices	$359.00
Sizes	100 µg
Host	Mouse
Clonality	Monoclonal
Isotype	IgG2a Kappa
Clone	2E10.
Applications	WB ELISA IHC-P
Species Reactivities	Human
Antigen	NDUFA8 (NP_055037.1, 1 a.a. - 72 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
Purity/Format	Protein A purified
Description	Mouse Monoclonal
Gene	NDUFA8
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of NDUFA8 expression in transfected 293T cell line by NDUFA8 monoclonal antibody (M05), clone 2E10. Lane 1: NDUFA8 transfected lysate (Predicted MW: 20.1 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml

Sandwich ELISA: NDUFA8 Antibody (2E10) [H00004702-M05] - Detection limit for recombinant GST tagged NDUFA8 is 0.03 ng/ml as a capture antibody.