NHLH2 Antibody (2A3)
| Name | NHLH2 Antibody (2A3) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00004808-M05 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2A3 |
| Applications | WB ELISA ICC/IF |
| Species Reactivities | Human |
| Antigen | NHLH2 (NP_005590, 36 a.a. - 135 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATR ERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | NHLH2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NHLH2 Antibody (2A3) [H00004808-M05] - Analysis of monoclonal antibody to NHLH2 on HeLa cell. Antibody concentration 10 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29059_NHLH2-Antibody-(2A3)-Immunocytochemistry-Immunofluorescence-H00004808-M05-img0003.jpg)
Immunocytochemistry/Immunofluorescence: NHLH2 Antibody (2A3) [H00004808-M05] - Analysis of monoclonal antibody to NHLH2 on HeLa cell. Antibody concentration 10 ug/ml
![Sandwich ELISA: NHLH2 Antibody (2A3) [H00004808-M05] - Detection limit for recombinant GST tagged NHLH2 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29060_NHLH2%2520Antibody%2520(2A3)-Sandwich%2520ELISA-H00004808-M05-img0004.jpg)
Sandwich ELISA: NHLH2 Antibody (2A3) [H00004808-M05] - Detection limit for recombinant GST tagged NHLH2 is approximately 0.1ng/ml as a capture antibody.