TTC19 Antibody

Name TTC19 Antibody
Supplier Novus Biologicals
Catalog NBP1-91534
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the N terminal of mouse TTC19. Peptide sequence RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene Ttc19
Conjugate Unconjugated
Supplier Page Shop

Product images