TNFAIP8L1 Antibody

Name TNFAIP8L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-91434
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen Synthetic peptide directed towards the middle region of human TNFAIP8L1. Peptide sequence AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TNFAIP8L1
Supplier Page Shop

Product images