UGCGL2 Antibody
| Name | UGCGL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79300 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptide directed towards the middle region of human UGCGL2The immunogen for this antibody is UGCGL2. Peptide sequence LCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDEL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UGGT2 |
| Supplier Page | Shop |
Product images
![Western Blot: UGCGL2 Antibody [NBP1-79300] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14244_UGCGL2%2520Antibody-Western%2520Blot-NBP1-79300-img0002.jpg)
Western Blot: UGCGL2 Antibody [NBP1-79300] - HepG2 cell lysate, concentration 0.2-1 ug/ml.