Ceramide Kinase Like Antibody

Name Ceramide Kinase Like Antibody
Supplier Novus Biologicals
Catalog NBP1-68988
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CERKL (ceramide kinase-like) The peptide sequence was selected from the C terminal of CERKL. Peptide sequence ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CERKL
Conjugate Unconjugated
Supplier Page Shop

Product images