LDHAL6B Antibody

Name LDHAL6B Antibody
Supplier Novus Biologicals
Catalog NBP1-55494
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LDHAL6B(lactate dehydrogenase A-like 6B) The peptide sequence was selected from the middle region of LDHAL6B. Peptide sequence SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LDHAL6B
Conjugate Unconjugated
Supplier Page Shop

Product images