SRRD Antibody
| Name | SRRD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70715 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SRRD(SRR1 domain containing) The peptide sequence was selected from the middle region of SRRD. Peptide sequence DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SRRD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SRRD Antibody [NBP1-70715] - Jurkat, Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14437_SRRD-Antibody-Western-Blot-NBP1-70715-img0004.jpg)
Western Blot: SRRD Antibody [NBP1-70715] - Jurkat, Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in Jurkat.
![Western Blot: SRRD Antibody [NBP1-70715] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14438_SRRD-Antibody-Western-Blot-NBP1-70715-img0002.jpg)
Western Blot: SRRD Antibody [NBP1-70715] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: SRRD Antibody [NBP1-70715] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14439_SRRD-Antibody-Western-Blot-NBP1-70715-img0003.jpg)
Western Blot: SRRD Antibody [NBP1-70715] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in 721_B.
![Western Blot: SRRD Antibody [NBP1-70715] - MCF7, Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in MCF7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14440_SRRD%2520Antibody-Western%2520Blot-NBP1-70715-img0005.jpg)
Western Blot: SRRD Antibody [NBP1-70715] - MCF7, Antibody Dilution: 1.0 ug/ml SRRD is supported by BioGPS gene expression data to be expressed in MCF7.